Home > Product > Catalog Peptides > Others > [Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT

Others

[Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT

[Price Inquiry]
CAT#
S06002
Sequence
CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF
M.W/Mr.
3376.9
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.