Home > Product > Catalog Peptides > Others > [Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT

Others

[Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT

Price Inquiry
CAT#
S06002
Sequence
CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF
M.W/Mr.
3376.9
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.