Home > Product > Catalog Peptides > β-Amyloid (1-42), (1-40), (1-46) and Fragments > [Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42)

β-Amyloid (1-42), (1-40), (1-46) and Fragments

[Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42)

Price Inquiry
CAT#
A13309
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
M.W/Mr.
4530.2
Length
42

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.