Home > Product > Antimicrobial Peptides > Cysteine-rich antifungal protein 1 (Bn-AFP1)

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cysteine-rich antifungal protein 1 (Bn-AFP1)

[Price Inquiry]
CAT#
AF3115
Sequence
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHK
Host Chemicals
Brassica napus
Length
44
Activity
Antifungal
SwissProt ID
P69240
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.