Home > Product > Catalog Peptides > Others > Cytotoxin-4

Others

Cytotoxin-4

[Price Inquiry]
CAT#
C44004
Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Modifications
Disulfide bond(4)
Length
60
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.