Home > Product > Antimicrobial Peptides > Daunchinain-B1 antimicrobial peptide precursor

Antimicrobial Peptides

Daunchinain-B1 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF3123
Sequence
TSKKPLLLLFFLGTINLSLCEQERNAEEETGDYPDQRDVEVEKR
Host Chemicals
Babina daunchina
Length
44
Activity
Antimicrobial
SwissProt ID
E1AXD1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.