Home > Product > Antimicrobial Peptides > Daunchinain-D1 antimicrobial peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Daunchinain-D1 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF3121
Sequence
TMKKSLLLLFFLGTINLSLCEQEGNAEEETGDNPDQREDEVEKR
Host Chemicals
Babina daunchina
Length
44
Activity
Antimicrobial
SwissProt ID
E1AXD4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.