Home > Product > Antimicrobial Peptides > Def-Bbb

Antimicrobial Peptides

CAT#
AF2312
Sequence
SQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCR
Host Chemicals
Anopheles gambiae
Length
33
Activity
Antibacterial
SwissProt ID
Q17027
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.