Home > Product > Antimicrobial Peptides > DEFB30

Antimicrobial Peptides

CAT#
AF3301
Sequence
GVNMYIRQIYDTCWKLKGHCRNVCGKKEIFHIFCGTQFLCCIERKEMPVLFVK
Host Chemicals
Rattus norvegicus
Length
53
Activity
Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.