Home > Product > Antimicrobial Peptides > Defense protein 4

Antimicrobial Peptides

Defense protein 4

[Price Inquiry]
CAT#
AF2861
Sequence
WDFLKELEGVGQRVRDSIISAGPAIDVLKKSQGPRRWSRP
Host Chemicals
Lonomia obliqua
Length
40
Activity
Antibacterial
SwissProt ID
Q5MGD8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.