Home > Product > Antimicrobial Peptides > Defense protein 6

Antimicrobial Peptides

Defense protein 6

[Price Inquiry]
CAT#
AF3016
Sequence
LTVRAAQSFGRCNQKQCDADCVKKGYFGGLCTLTSCFCTGSRS
Host Chemicals
Lonomia obliqua
Length
43
Activity
Antibacterial
SwissProt ID
Q5MGC9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.