Home > Product > Antimicrobial Peptides > Defensin B

Antimicrobial Peptides

Defensin B

[Price Inquiry]
CAT#
AF2639
Sequence
GYGCPFNQYQCHSHCRGIRGYKGGYCTGRFKQTCKCY
Host Chemicals
Ornithodoros moubata
Length
37
Activity
Antibacterial
SwissProt ID
Q9BLJ4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.