Home > Product > Antimicrobial Peptides > Defensin-B

Antimicrobial Peptides

Defensin-B

[Price Inquiry]
CAT#
AF2810
Sequence
ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN
Host Chemicals
Aedes aegypti
Length
40
Activity
Antibacterial
SwissProt ID
P81602
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.