Home > Product > Antimicrobial Peptides > Defensin-B1

Antimicrobial Peptides

Defensin-B1

[Price Inquiry]
CAT#
AF2420
Sequence
GMKEKCVTMGGYCRKQCRVQDALSGYCRNENPCCV
Host Chemicals
Ornithorhynchus anatinus
Length
35
Activity
Antimicrobial
SwissProt ID
P0C8A5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.