Home > Product > Antimicrobial Peptides > Defensin-B2

Antimicrobial Peptides

Defensin-B2

[Price Inquiry]
CAT#
AF2940
Sequence
GLNNKCAYFRGQCRRKCPQRDIFFGFCRNHDQCCLSSLHTRH
Host Chemicals
Ornithorhynchus anatinus
Length
42
Activity
Antimicrobial
SwissProt ID
P0C8A6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.