Home > Product > Antimicrobial Peptides > Defensin-B5

Antimicrobial Peptides

Defensin-B5

[Price Inquiry]
CAT#
AF2126
Sequence
KKCRERGGQCHSGVCSWNEKFIGFCSFARPCC
Host Chemicals
Ornithorhynchus anatinus
Length
32
Activity
Antimicrobial
SwissProt ID
P0C8A9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.