Home > Product > Antimicrobial Peptides > Defensin, beta 107A

Antimicrobial Peptides

Defensin, beta 107A

Price Inquiry
CAT#
AF3053
Sequence
AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
Host Chemicals
Homo sapiens
Length
44
Activity
Antimicrobial
SwissProt ID
Q8IZN7

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.