Home > Product > Antimicrobial Peptides > Defensin, beta 107A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Defensin, beta 107A

[Price Inquiry]
CAT#
AF3053
Sequence
AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
Host Chemicals
Homo sapiens
Length
44
Activity
Antimicrobial
SwissProt ID
Q8IZN7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.