Home > Product > Antimicrobial Peptides > Defensin C

Antimicrobial Peptides

Defensin C

[Price Inquiry]
CAT#
AF2640
Sequence
GYGCPFNQYQCHSHCSGIRGYKGGYCKGLFKQTCNCY
Host Chemicals
Ornithodoros moubata
Length
37
Activity
Antibacterial
SwissProt ID
Q8MY08
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.