Home > Product > Antimicrobial Peptides > Defensin D

Antimicrobial Peptides

Defensin D

[Price Inquiry]
CAT#
AF2577
Sequence
GFGCPFNQYECHAHCSGVPGYKGGYCKGLFKQTCNCY
Host Chemicals
Ornithodoros moubata
Length
37
Activity
Antibacterial
SwissProt ID
Q8MY07
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.