Home > Product > Antimicrobial Peptides > Defensin-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Defensin-1

[Price Inquiry]
CAT#
AF2074
Sequence
ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ
Host Chemicals
Centruroides limpidus limpidus
Length
32
Activity
Antibacterial
SwissProt ID
Q6GU94
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.