CAT# | AF2074 |
Sequence | ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ |
Activity | Antibacterial |
Host Chemicals | Centruroides limpidus limpidus | Length | 32 | SwissProt ID | Q6GU94 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF085 | Temporin-K | Inquiry | ||
AF901 | Chemerin peptide 4 | Inquiry | ||
AF1855 | Def-Acaa | Inquiry | ||
AF2528 | Beta defensin 3 | Inquiry | ||
AF2535 | Sperm associated antigen 11 isoform E | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...