Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

CAT#
AF2156
Sequence
TCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCT
Host Chemicals
Malus x domestica
Length
32
Activity
Antimicrobial
SwissProt ID
I0CCB1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.