Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2497
Sequence
GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCY
Host Chemicals
Dermacentor variabilis
Length
36
Activity
Antibacterial
SwissProt ID
Q86QI5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.