Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

CAT#
AF2703
Sequence
GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYRN
Host Chemicals
Rhipicephalus microplus
Length
38
Activity
Antibacterial
SwissProt ID
Q86LE4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.