Home > Product > Antimicrobial Peptides > Defensin-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Defensin-1

[Price Inquiry]
CAT#
AF2708
Sequence
GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS
Host Chemicals
Crassostrea virginica
Length
38
Activity
Antibacterial
SwissProt ID
P85008
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.