Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

CAT#
AF2818
Sequence
ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN
Host Chemicals
Drosophila melanogaster
Length
40
Activity
Antibacterial
SwissProt ID
P36192
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.