Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

CAT#
AF2979
Sequence
ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR
Host Chemicals
Pyrrhocoris apterus
Length
43
Activity
Antibacterial
SwissProt ID
P37364
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.