Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3078
Sequence
DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCEE
Host Chemicals
Galleria mellonella
Length
44
Activity
Antifungal
SwissProt ID
P85213
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.