Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

CAT#
AF3109
Sequence
MVRARRGCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN
Host Chemicals
Ornithodoros coriaceus
Length
44
Activity
Antibacterial
SwissProt ID
B2D2C0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.