Home > Product > Antimicrobial Peptides > Defensin-like peptide

Antimicrobial Peptides

Defensin-like peptide

[Price Inquiry]
CAT#
AF3062
Sequence
DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCEE
Host Chemicals
Galleria mellonella
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
P85215
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.