Home > Product > Antimicrobial Peptides > Defensin-like peptide

Antimicrobial Peptides

Defensin-like peptide

Price Inquiry
CAT#
AF3062
Sequence
DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCEE
Host Chemicals
Galleria mellonella
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
P85215

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.