Home > Product > Catalog Peptides > Others > Defensin-like peptide 1

Others

warning All products are for research use only. Not for human use.

Defensin-like peptide 1

[Price Inquiry]
CAT#
D06001
Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDEQKCCRK
Modifications
Disulfide bonds(3)
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.