Home > Product > Catalog Peptides > Others > Defensin-like peptide 2/4

Others

Defensin-like peptide 2/4

[Price Inquiry]
CAT#
D06002
Sequence
IMFFEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKCCEY
Modifications
Disulfide bonds(3)
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.