Home > Product > Antimicrobial Peptides > Defensin-like protein 10

Antimicrobial Peptides

Defensin-like protein 10

[Price Inquiry]
CAT#
AF3171
Sequence
RTCESPSNKFQGVCLNSQSCAKACPSEGFSGGRCSSLRCYCSKAC
Host Chemicals
Arabidopsis thaliana
Length
45
Activity
Antifungal
SwissProt ID
Q9ZUL8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.