Home > Product > Antimicrobial Peptides > Defensin-like protein 10

Antimicrobial Peptides

Defensin-like protein 10

Price Inquiry
CAT#
AF3171
Sequence
RTCESPSNKFQGVCLNSQSCAKACPSEGFSGGRCSSLRCYCSKAC
Host Chemicals
Arabidopsis thaliana
Length
45
Activity
Antifungal
SwissProt ID
Q9ZUL8

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.