CAT# | AF3171 |
Sequence | RTCESPSNKFQGVCLNSQSCAKACPSEGFSGGRCSSLRCYCSKAC |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...