Home > Product > Catalog Peptides > Others > Defensin-like protein 4

Others

Defensin-like protein 4

[Price Inquiry]
CAT#
D06004
Sequence
RTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRCFCTRNC
Modifications
Disulfide bonds(4)
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.