Home > Product > Catalog Peptides > Others > Defensin-like protein 17

Others

Defensin-like protein 17

[Price Inquiry]
CAT#
D06008
Sequence
QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
Modifications
Disulfide bonds(4)
Length
51
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.