Home > Product > Antimicrobial Peptides > Defensin MGD-1 precursor

Antimicrobial Peptides

Defensin MGD-1 precursor

[Price Inquiry]
CAT#
AF2707
Sequence
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
Host Chemicals
Mytilus galloprovincialis
Length
38
Activity
Antibacterial
SwissProt ID
P80571
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.