Home > Product > Antimicrobial Peptides > Defensin-related cryptdin 4

Antimicrobial Peptides

Defensin-related cryptdin 4

[Price Inquiry]
CAT#
AF2102
Sequence
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
Host Chemicals
Mus musculus
Length
32
Activity
Antibacterial
SwissProt ID
P28311
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.