Home > Product > Antimicrobial Peptides > Defensin-related cryptdin-20

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Defensin-related cryptdin-20

[Price Inquiry]
CAT#
AF2390
Sequence
SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR
Host Chemicals
Mus musculus
Length
34
Activity
Antimicrobial
SwissProt ID
Q45VN2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.