Home > Product > Antimicrobial Peptides > Defensin Tk-AMP-D4

Antimicrobial Peptides

Defensin Tk-AMP-D4

[Price Inquiry]
CAT#
AF3166
Sequence
RDCTSQSHKFVGLCLSDRNCASVCLTEYFTGGKCDHRRCVCTKGC
Host Chemicals
Triticum kiharae
Length
45
Activity
Antimicrobial
SwissProt ID
P84971
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.