Home > Product > Antimicrobial Peptides > Defensin Tk-AMP-D4

Antimicrobial Peptides

Defensin Tk-AMP-D4

Price Inquiry
CAT#
AF3166
Sequence
RDCTSQSHKFVGLCLSDRNCASVCLTEYFTGGKCDHRRCVCTKGC
Host Chemicals
Triticum kiharae
Length
45
Activity
Antimicrobial
SwissProt ID
P84971

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.