Home > Product > Antimicrobial Peptides > Defensin5

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2431
Sequence
LRDLKCFCRRKSCNWGEGIMGICKKRYGSPILCCR
Host Chemicals
Rattus norvegicus
Length
35
Activity
Antimicrobial
SwissProt ID
P82106
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.