Home > Product > Catalog Peptides > Others > Delta-theraphotoxin-Cj1a

Others

Delta-theraphotoxin-Cj1a

[Price Inquiry]
CAT#
C40011
Sequence
ACGQFWWKCGEGKPPCCANFACKIGLYLCIWSP
Modifications
Disulfide bond(3)
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.