Home > Product > Antimicrobial Peptides > Dendrocin

Antimicrobial Peptides

CAT#
AF2473
Sequence
TTLTLHNLCPYPVWWLVTPNNGGFPIIDNTPVVLG
Host Chemicals
Dendrocalamus latiflorus Munro
Length
35
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.