Home > Product > Antimicrobial Peptides > Dermadistinctin-M

Antimicrobial Peptides

Dermadistinctin-M

[Price Inquiry]
CAT#
AF1988
Sequence
ALWKTMLKKLGTMALHAGKAAFGAAADTISQ
Host Chemicals
Phyllomedusa distincta
Length
31
Activity
Antibacterial
SwissProt ID
P83640
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.