Home > Product > Antimicrobial Peptides > Dermaseptin B2

Antimicrobial Peptides

Dermaseptin B2

[Price Inquiry]
CAT#
AF1990
Sequence
AMWKDVLKKIGTVALHAGKAALGAVADTISQ
Host Chemicals
Phyllomedusa bicolor
Length
31
Activity
Antibacterial, Antifungal
SwissProt ID
P80282
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.