Home > Product > Antimicrobial Peptides > Dermaseptin B2

Antimicrobial Peptides

Dermaseptin B2

Price Inquiry
CAT#
AF1990
Sequence
AMWKDVLKKIGTVALHAGKAALGAVADTISQ
Host Chemicals
Phyllomedusa bicolor
Length
31
Activity
Antibacterial, Antifungal
SwissProt ID
P80282

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.