Home > Product > Antimicrobial Peptides > Dermaseptin-3

Antimicrobial Peptides

Dermaseptin-3

[Price Inquiry]
CAT#
AF1874
Sequence
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES
Host Chemicals
Phyllomedusa bicolor
Length
30
Activity
Antibacterial
SwissProt ID
P81488
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.