Home > Product > Antimicrobial Peptides > Dermaseptin-3

Antimicrobial Peptides

Dermaseptin-3

[Price Inquiry]
CAT#
AF1928
Sequence
GLFKTLIKGAGKMLGHVAKQFLGSQGQPES
Host Chemicals
Phyllomedusa tarsius
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P84923
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.