Home > Product > Antimicrobial Peptides > Dermaseptin-2

Antimicrobial Peptides

Dermaseptin-2

[Price Inquiry]
CAT#
AF2335
Sequence
ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ
Host Chemicals
Phyllomedusa sauvagii
Length
34
Activity
Antibacterial, Antifungal
SwissProt ID
P80278
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.