Home > Product > Antimicrobial Peptides > Dermaseptin-S8

Antimicrobial Peptides

Dermaseptin-S8

[Price Inquiry]
CAT#
AF1989
Sequence
ALWKTMLKKLGTVALHAGKAALGAAADTISQ
Host Chemicals
Phyllomedusa sauvagei
Length
31
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.