Home > Product > Antimicrobial Peptides > DermaseptinAA-1-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

DermaseptinAA-1-1

[Price Inquiry]
CAT#
AF1974
Sequence
SLGSFMKGVGKGLATVGKIVADQFGKLLEA
Host Chemicals
Agalychnis annae
Length
30
Activity
Antibacterial
SwissProt ID
O93221
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.