Home > Product > Antimicrobial Peptides > DermaseptinAA-1-1

Antimicrobial Peptides

DermaseptinAA-1-1

Price Inquiry
CAT#
AF1974
Sequence
SLGSFMKGVGKGLATVGKIVADQFGKLLEA
Host Chemicals
Agalychnis annae
Length
30
Activity
Antibacterial
SwissProt ID
O93221

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.