Home > Product > Antimicrobial Peptides > Dermatoxin S1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Dermatoxin S1

[Price Inquiry]
CAT#
AF2175
Sequence
ALGTLLKGVGSAVATVGKMVADQFGKLLQAGQG
Host Chemicals
Phyllomedusa sauvagei
Length
33
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.