Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > [Des - His1, Glu9] - Glucagon (1 - 29), amide

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

warning All products are for research use only. Not for human use.

[Des - His1, Glu9] - Glucagon (1 - 29), amide

[Price Inquiry]
CAT#
G05006
Sequence
SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2
M.W/Mr.
3358.7
Length
28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.